PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678335571
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family HD-ZIP
Protein Properties Length: 291aa    MW: 32152.2 Da    PI: 8.2834
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678335571genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-19128182256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +k+ +++keq  +Lee F+++++++ ++++eLA +l+L+ rqV vWFqNrRa+ k
  678335571 128 KKKLRLSKEQAAVLEETFKEHNTLNPKQKKELAIQLKLQPRQVEVWFQNRRARTK 182
                678899***********************************************98 PP

2HD-ZIP_I/II125.81.9e-40128217191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++K+ela +L+lqprqv+vWFqnrRARtk+kq+E+d+e+L+r++d+l+een+rL+ke +eLr +l
    678335571 128 KKKLRLSKEQAAVLEETFKEHNTLNPKQKKELAIQLKLQPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCDNLTEENRRLQKELTELR-AL 217
                  59*************************************************************************************9.54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.5E-234105IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.135124184IPR001356Homeobox domain
SuperFamilySSF466899.41E-19125193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-18125187IPR009057Homeodomain-like
SMARTSM003897.9E-16126188IPR001356Homeobox domain
PfamPF000461.3E-16128182IPR001356Homeobox domain
CDDcd000863.86E-16128185No hitNo description
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PfamPF021831.1E-10184218IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.4E-25184227IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAEEVGLGLS LSLGFPEKAP PPPAAGPFPL NLFRSPLQMG QQGKSGRGEQ FRTSGADGSL  60
ENRSVFRGID MNRAATSVID CDEDAMASSP NSTVSSLSGK RSEREENDGE RACSSLEIDD  120
DGGDPSAKKK LRLSKEQAAV LEETFKEHNT LNPKQKKELA IQLKLQPRQV EVWFQNRRAR  180
TKLKQTEVDC EYLRRCCDNL TEENRRLQKE LTELRALKLS PQFYMNMSPP TTLIMCPQCE  240
RVNVSSTTAS SAVGAVTPPR QAAHHQRTLP VNSWAAAIFA SQPPDANRPR T
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176184RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-137PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054664e-89HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A068UP951e-107A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.14e-86homeobox protein 2